missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PLUNC Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-58979
This item is not returnable.
View return policy
Description
PLUNC Polyclonal specifically detects PLUNC in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| PLUNC | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| bA49G10.5, ligand-binding protein RYA3, LPLUNC3, Lung-specific protein X, LUNXNASG, Nasopharyngeal carcinoma-related protein, Palate lung and nasal epithelium clone protein, palate, lung and nasal epithelium associated, palate, lung and nasal epithelium carcinoma associated, protein Plunc, Secretory protein in upper respiratory tracts, SPLUNC1SPURT, tracheal epithelium enriched protein, Tracheal epithelium-enriched protein, Von Ebner protein Hl | |
| Rabbit | |
| 28 kDa | |
| 100 μL | |
| Immunology | |
| 51297 | |
| Human, Mouse, Rat, Bovine, Canine, Guinea Pig, Goat, Rabbit | |
| IgG |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500 | |
| Q9NP55 | |
| BPIFA1 | |
| Synthetic peptides corresponding to PLUNC(palate, lung and nasal epithelium carcinoma associated) The peptide sequence was selected from the middle region of PLUNC (NP_057667). Peptide sequence GLNNIIDIKVTDPQLLELGLVQSPDGHRLYVTIPLGIKLQVNTPLVGASL. | |
| Affinity purified | |
| RUO | |
| Primary | |
| Reconstitute with 50μL distilled water to a final concentration of 1mg/mL. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction