missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PMCH Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 280.00 - € 556.50
Specifications
| Antigen | PMCH |
|---|---|
| Dilution | Immunohistochemistry-Paraffin 1:20 - 1:50 |
| Applications | Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18212752
|
Novus Biologicals
NBP2-57697 |
100 μL |
 € 589.00 € 556.50 / 100µL Save € 32.50 5% Off |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18615407
|
Novus Biologicals
NBP2-57697-25ul |
25 μL |
€ 280.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
PMCH Polyclonal specifically detects PMCH in Human, Mouse samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| PMCH | |
| Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human, Mouse | |
| 5367 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KGSVAFPAENGVQNTESTQEKREIGDEENSAKFPIGRRDFDMLRCMLGRVYRPCW | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| Polyclonal | |
| Rabbit | |
| Neuroscience | |
| MCHpro-MCH, pro-melanin-concentrating hormone | |
| PMCH | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title