missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
POLDIP2 Polyclonal antibody specifically detects POLDIP2 in Human, Mouse, Rat samples. It is validated for Western Blot
Specifications
Specifications
| Antigen | POLDIP2 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1:500-1:2000 |
| Formulation | PBS (pH 7.3), 50% glycerol |
| Gene Alias | DKFZP586F1524, p38, PDIP38DKFZp586F1524,38 kDa DNA polymerase delta interaction protein, POLD4, polymerase (DNA-directed), delta interacting protein 2, polymerase delta interacting protein 38, polymerase delta-interacting protein 2 |
| Host Species | Rabbit |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 250-350 of human POLDIP2 (NP_056399.1). MGMREAQNSHVYWWRYCIRLENLDSDVVQLRERHWRIFSLSGTLETVRGRGVVGREPVLSKEQPAFQYSSHVSLQASSGHMWGTFRFERPDGSHFDVRIPP |
| Purification Method | Affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?