missing translation for 'onlineSavingsMsg'
Learn More
Learn More
POLR2E Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 369.00 - € 593.00
Specifications
| Antigen | POLR2E |
|---|---|
| Applications | Western Blot, Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18200684
|
Novus Biologicals
NBP2-57185 |
100 μL |
€ 593.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18658326
|
Novus Biologicals
NBP2-57185-25ul |
25 μL |
€ 369.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
POLR2E Polyclonal specifically detects POLR2E in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
| POLR2E | |
| Polyclonal | |
| Rabbit | |
| DNA replication Transcription Translation and Splicing | |
| DNA directed RNA polymerase II 23 kda polypeptide, DNA-directed RNA polymerase II 23 kDa polypeptide, DNA-directed RNA polymerase II subunit E, DNA-directed RNA polymerases I, II, and III subunit RPABC1, hRPB25, hsRPB5, polymerase (RNA) II (DNA directed) polypeptide E (25kD), polymerase (RNA) II (DNA directed) polypeptide E, 25kDa, RPABC1, RPB5, RPB5 homolog, XAP4RNA polymerases I, II, and III subunit ABC1 | |
| POLR2E | |
| IgG | |
| Affinity Purified |
| Western Blot, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 5434 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ELLINITEHELVPEHVVMTKEEVTELLARYKLRENQLPRIQAGDPVARYFGIKRGQVVKIIRPSETAGRY | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title