missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Polypeptide GalNac Transferase 7/GALNT7 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-39021
This item is not returnable.
View return policy
Description
Polypeptide GalNac Transferase 7/GALNT7 Polyclonal antibody specifically detects Polypeptide GalNac Transferase 7/GALNT7 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin).
Specifications
| Polypeptide GalNac Transferase 7/GALNT7 | |
| Polyclonal | |
| Western Blot 1:250 - 1:500, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Q86SF2 | |
| GALNT7 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: GDSQKDIMQRQYLTFKPQTFTYHDPVLRPGILGNFEPKEPEPPGVVGGPGEKAKPLVLGPEFKRAI | |
| 0.1 mL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| EC 2.4.1, EC 2.4.1.-, EC 2.4.1.37, EC 2.4.1.41, GalNAcT7, GalNAc-T7, N-acetylgalactosaminyltransferase 7, Polypeptide GalNAc transferase 7, polypeptide N-acetylgalactosaminyltransferase 7, pp-GaNTase 7, Protein-UDP acetylgalactosaminyltransferase 7, UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 7, UDP-N-acetyl-alpha-D-galactosamine:polypeptideN-acetylgalactosaminyltransferase 7 (GalNAc-T7) | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 51809 | |
| Human, Mouse | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction