missing translation for 'onlineSavingsMsg'
Learn More
Learn More
POU3F2/OCT7 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-55453-25ul
This item is not returnable.
View return policy
Description
POU3F2/OCT7 Polyclonal specifically detects POU3F2/OCT7 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Specifications
| POU3F2/OCT7 | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL | |
| Brain-2, Brain-specific homeobox/POU domain protein 2, brn-2, BRN2brain-2, Nervous system-specific octamer-binding transcription factor N-Oct-3, Oct-7, OCT7POU domain class 3, transcription factor 2, Octamer-binding protein 7, Octamer-binding transcription factor 7, OTF7, OTF-7, POU class 3 homeobox 2, POU domain, class 3, transcription factor 2, POUF3 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
| Immunocytochemistry, Immunofluorescence, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| POU3F2 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ASNHYSLLTSSASIVHAEPPGGMQQGAGGYREAQSLVQGDYGALQSNGHP | |
| 25 μL | |
| Transcription Factors and Regulators | |
| 5454 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction