missing translation for 'onlineSavingsMsg'
Learn More
Learn More
POU5F1P1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 415.00 - € 624.00
Specifications
| Antigen | POU5F1P1 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18259784
|
Novus Biologicals
NBP2-55475 |
100 μL |
€ 624.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18669017
|
Novus Biologicals
NBP2-55475-25ul |
25 μL |
€ 415.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
POU5F1P1 Polyclonal specifically detects POU5F1P1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| POU5F1P1 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| OCT4-PG1, Octamer-binding protein 3-like, Octamer-binding transcription factor 3-like, OTF3Coctamer binding protein 3_like sequence, OTF3P1, POU 5 domain protein, POU class 5 homeobox 1 pseudogene 1, POU class 5 homeobox 1B, POU domain class 5, transcription factor 1 pseudogene 1, POU domain transcription factor Oct-4, POU domain transcription factor OCT4-pg1, POU domain, class 5, transcription factor 1 pseudogene 1, POU5F1P1, POU5F1P4, POU5FLC20, POU5FLC8, putative POU domain, class 5, transcription factor 1B | |
| POU5F1B | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 5462 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VGPGSEVWGIPPCPPPYELCGGMAYCGPQVGVGLVPQGGLETSQPESEAGV | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title