missing translation for 'onlineSavingsMsg'
Learn More

PPP1R14B Antibody - Azide and BSA Free, Novus Biologicals™

Product Code. 18618220 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.02 mL
0.1 mL
Unit Size:
0.02mL
0.1mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18618220 0.1 mL 0.1mL
18603880 0.02 mL 0.02mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18618220 Supplier Novus Biologicals Supplier No. NBP2937490.1ml

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

PPP1R14B Polyclonal antibody specifically detects PPP1R14B in Human, Mouse, Rat samples. It is validated for Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen PPP1R14B
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:500-1:2000
Formulation PBS (pH 7.3), 50% glycerol
Gene Alias PHI-1, PLCB3Nphospholipase C beta-3 neighboring gene protein, PNGPhospholipase C-beta-3 neighbouring gene protein, protein phosphatase 1 regulatory subunit 14B, protein phosphatase 1, regulatory (inhibitor) subunit 14B, SOM172
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 68-147 of human PPP1R14B (NP_619634.1). RLNLEEWILEQLTRLYDCQEEEIPELEIDVDELLDMESDDARAARVKELLVDCYKPTEAFISGLLDKIRGMQKLSTPQKK
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Neuroscience, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 26472
Target Species Human, Mouse, Rat
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.