missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PPP1R14B Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 188.00 - € 470.00
Specifications
| Antigen | PPP1R14B |
|---|---|
| Dilution | Western Blot 1:500-1:2000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18603880
|
Novus Biologicals
NBP2-93749-0.02ml |
0.02 mL |
€ 188.00
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18618220
|
Novus Biologicals
NBP2-93749-0.1ml |
0.1 mL |
€ 470.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
PPP1R14B Polyclonal antibody specifically detects PPP1R14B in Human, Mouse, Rat samples. It is validated for Western BlotSpecifications
| PPP1R14B | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Neuroscience, Signal Transduction | |
| PBS (pH 7.3), 50% glycerol | |
| 26472 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500-1:2000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| PHI-1, PLCB3Nphospholipase C beta-3 neighboring gene protein, PNGPhospholipase C-beta-3 neighbouring gene protein, protein phosphatase 1 regulatory subunit 14B, protein phosphatase 1, regulatory (inhibitor) subunit 14B, SOM172 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 68-147 of human PPP1R14B (NP_619634.1). RLNLEEWILEQLTRLYDCQEEEIPELEIDVDELLDMESDDARAARVKELLVDCYKPTEAFISGLLDKIRGMQKLSTPQKK | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title