missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Profilin 2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
Brand: Novus Biologicals NBP1-87426-25ul
This item is not returnable.
View return policy
Description
Profilin 2 Polyclonal specifically detects Profilin 2 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
| Profilin 2 | |
| Polyclonal | |
| Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence validated from a verified customer review., Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| D3S1319E, PFL, profilin 2, Profilin II, profilin-2 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of human Profilin 2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| PFN2 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:QEAAIVGYCDAKYVWAATAGGVFQSITPIEIDMIVGKDREGFFTNGLTLGAKKCSVIRD | |
| 25 μL | |
| Cytoskeleton Markers, Signal Transduction, Stem Cell Markers | |
| 5217 | |
| Human, Mouse, Rat | |
| IgG |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
For Research Use Only
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido