missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Prokineticin 2 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 201.00 - € 481.00
Specifications
| Antigen | Prokineticin 2 |
|---|---|
| Dilution | Western Blot 1:1000 - 1:5000, Immunohistochemistry 1:50-1:100, Immunocytochemistry/ Immunofluorescence 1:50-1:100, Immunohistochemistry-Paraffin |
| Applications | Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18671882
|
Novus Biologicals
NBP2-94101-0.02ml |
0.02 mL |
€ 201.00
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18678741
|
Novus Biologicals
NBP2-94101-0.1ml |
0.1 mL |
€ 481.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Prokineticin 2 Polyclonal antibody specifically detects Prokineticin 2 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)Specifications
| Prokineticin 2 | |
| Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Angiogenesis | |
| PBS (pH 7.3), 50% glycerol | |
| 60675 | |
| IgG | |
| Affinity purified |
| Western Blot 1:1000 - 1:5000, Immunohistochemistry 1:50-1:100, Immunocytochemistry/ Immunofluorescence 1:50-1:100, Immunohistochemistry-Paraffin | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| BV8Protein Bv8 homolog, KAL4, MIT1, PK2prokineticin-2, prokineticin 2 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 20-129 of human PROK2 (NP_001119600.1). LTPRAGDAAVITGACDKDSQCGGGMCCAVSIWVKSIRICTPMGKLGDSCHPLTRKNNFGNGRQERRKRKRSKRKKEVPFFGRRMHHTCPCLPGLACLRTSFNRFICLAQK | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title