missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Proline Rich 35 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-48809-25ul
This item is not returnable.
View return policy
Description
Proline Rich 35 Polyclonal antibody specifically detects Proline Rich 35 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| Proline Rich 35 | |
| Polyclonal | |
| Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| chromosome 16 open reading frame 11, hypothetical protein LOC146325, LA16c-366D1.2, Uncharacterized protein RJD1 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: EHVGEDLTRALGDYARVEQRLGQLGPAGGLAPRPLREQLGKIRLELLTIHQALEQAVRPPDAPLDLSVKRA | |
| 25 μL | |
| Primary | |
| Human | |
| Purified |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| 146325 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction