missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Prostasin/Prss8 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 483.00
Specifications
| Antigen | Prostasin/Prss8 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
Prostasin/Prss8 Polyclonal specifically detects Prostasin/Prss8 in Human samples. It is validated for Western Blot.Specifications
| Prostasin/Prss8 | |
| Polyclonal | |
| Rabbit | |
| Q16651 | |
| 5652 | |
| Synthetic peptides corresponding to PRSS8 (protease, serine, 8) The peptide sequence was selected from the middle region of PRSS8. Peptide sequence PITFSRYIRPICLPAANASFPNGLHCTVTGWGHVAPSVSLLTPKPLQQLE. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| CAP1, channel-activating protease 1, EC 3.4.21, EC 3.4.21.-, EC 3.4.21.120, PROSTASIN, protease, serine, 8, Serine protease 8 | |
| PRSS8 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title