missing translation for 'onlineSavingsMsg'
Läs mer
Läs mer
Proteasome 19S S7 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 386.00 - € 529.00
Specifikationer
| Antigen | Proteasome 19S S7 |
|---|---|
| Dilution | Western Blot 0.4 ug/ml, Simple Western, Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Produktkod | Brand | Quantity | Pris | Kvantitet och tillgänglighet | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktkod | Brand | Quantity | Pris | Kvantitet och tillgänglighet | |||||
|
18493702
|
Novus Biologicals
NBP1-87797-25ul |
25 μL |
€ 386.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18751144
|
Novus Biologicals
NBP1-87797 |
€ 529.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||||
Beskrivning
Proteasome 19S S7 Polyclonal specifically detects Proteasome 19S S7 in Human, Mouse, Rat samples. It is validated for Western Blot, Simple Western, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifikationer
| Proteasome 19S S7 | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human, Mouse, Rat | |
| 26S protease regulatory subunit 7, 26S proteasome AAA-ATPase subunit RPT1, MGC3004, MSS1ATPase, 2, proteasome (prosome, macropain) 26S subunit, ATPase, 2, Protein MSS1, putative protein product of Nbla10058 | |
| PSMC2 | |
| IgG | |
| Affinity Purified | |
| Specificity of human Proteasome 19S S7 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot 0.4 ug/ml, Simple Western, Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| Polyclonal | |
| Rabbit | |
| Neuroscience, Ubiquitin Proteasome Pathway | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 5701 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:RKTKEDEKDDKPIRALDEGDIALLKTYGQSTYSRQIKQVEDDIQQLLKKINELTGIKESDTGLAPPALWDLAA | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Hittar du en möjlighet till förbättring?Dela en innehållskorrigering
Korrigering av produktinnehåll
Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.
Produkttitel