missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Protein Kinase A regulatory subunit I alpha Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 285.00 - € 593.00
Specifications
| Antigen | Protein Kinase A regulatory subunit I alpha |
|---|---|
| Dilution | Western Blot 0.4 ug/ml, Simple Western 4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18468361
|
Novus Biologicals
NBP2-33585-25ul |
25 μL |
€ 285.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18138403
|
Novus Biologicals
NBP2-33585 |
0.1 mL |
€ 593.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Protein Kinase A regulatory subunit I alpha Polyclonal specifically detects Protein Kinase A regulatory subunit I alpha in Human samples. It is validated for Western Blot, Simple Western, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| Protein Kinase A regulatory subunit I alpha | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| P10644 | |
| 5573 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: MAFLREYFERLEKEEAKQIQNLQKAGTRTDSREDEISPPPP | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot 0.4 ug/ml, Simple Western 4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Rabbit | |
| Cancer | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| cAMP-dependent protein kinase regulatory subunit RIalpha, cAMP-dependent protein kinase type I-alpha regulatory chain, cAMP-dependent protein kinase type I-alpha regulatory subunit, CAR, CNC, CNC1, MGC17251, PKA R1 alpha, PKA1, PKR1, PPNAD1, PRKAR1, protein kinase A type 1a regulatory subunit, protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specificextinguisher 1), Tissue-specific extinguisher 1, TSE1DKFZp779L0468 | |
| PRKAR1A | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title