missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PSMB11 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 415.00 - € 624.00
Specifications
| Antigen | PSMB11 |
|---|---|
| Dilution | Immunohistochemistry 1:5000 - 1:10000, Immunohistochemistry-Paraffin 1:5000 - 1:10000 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18480122
|
Novus Biologicals
NBP2-34158-25ul |
25 μL |
€ 415.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18195922
|
Novus Biologicals
NBP2-34158 |
0.1 mL |
€ 624.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
PSMB11 Polyclonal specifically detects PSMB11 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| PSMB11 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| BETA5T, EC 3.4.25.1, Proteasome (Prosome, Macropain) Subunit, Beta Type, 11, Proteasome Subunit Beta 5T, Proteasome Subunit Beta Type-11, Proteasome Subunit Beta-5t | |
| PSMB11 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry 1:5000 - 1:10000, Immunohistochemistry-Paraffin 1:5000 - 1:10000 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| A5LHX3 | |
| 122706 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: GSVDLFHVRESGWEHVSRSDACVLYVELQKLLEPEPEEDASHAHPEPATAHRAAEDRELSVGPGEVTPGDSRMPAGTET | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title