missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PSMB7 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 415.00 - € 624.00
Specifications
| Antigen | Proteasome 20S beta 7 |
|---|---|
| Applications | Western Blot, Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18248082
|
Novus Biologicals
NBP2-58648 |
100 μL |
€ 624.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18670259
|
Novus Biologicals
NBP2-58648-25ul |
25 μL |
€ 415.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
PSMB7 Polyclonal specifically detects PSMB7 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
| Proteasome 20S beta 7 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| 5695 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LVSEAIAAGIFNDLGSGSNIDLCVISKNKLDFLRPYTVPNKKGTRLGRYRCEKGTTAVLTEKITPLEIEVLEETVQTM | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| EC 3.4.25.1, Macropain chain Z, Multicatalytic endopeptidase complex chain Z, proteasome (prosome, macropain) subunit, beta type, 7, proteasome subunit alpha, proteasome subunit beta 7, proteasome subunit beta type-7, Proteasome subunit Z, PSMB7, Zproteasome catalytic subunit 2 | |
| PSMB7 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title