missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PSMD13 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 415.00 - € 572.00
Specifications
| Antigen | PSMD13 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18616615
|
Novus Biologicals
NBP2-38426-25ul |
25 μL |
€ 415.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18149967
|
Novus Biologicals
NBP2-38426 |
0.1 mL |
€ 572.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
PSMD13 Polyclonal specifically detects PSMD13 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| PSMD13 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Q9UNM6 | |
| 5719 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: ERAFTLGLAGLLGEGVFNFGELLMHPVLESLRNTDRQWLIDTLYAFNSGNVERFQTLKTAWGQQPDLAANEAQLLR | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| HSPC027,26S proteasome regulatory subunit RPN9, p40.5,26S proteasome subunit p40.5,26S proteasome regulatory subunit p40.5, proteasome (prosome, macropain) 26S subunit, non-ATPase, 13,26S proteasome regulatory subunit S11, Rpn9,26S proteasome non-ATPase regulatory subunit 13, S11 | |
| PSMD13 | |
| IgG | |
| Affinity Purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title