missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PSP94/MSMB Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 369.00 - € 560.70
Specifications
| Antigen | Prostate Secretory Protein/PSP |
|---|---|
| Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18463162
|
Novus Biologicals
NBP2-33610-25ul |
25 μL |
€ 369.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18144902
|
Novus Biologicals
NBP2-33610 |
0.1 mL |
€ 593.00 € 560.70 / 0.10mL Save € 32.30 5% Off |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
PSP94/MSMB Polyclonal specifically detects PSP94/MSMB in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| Prostate Secretory Protein/PSP | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| P08118 | |
| 4477 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: LKGNKHPINSEWQTDNCETCTCYETEISCCTLVSTPVGYDKDNCQRIFKKEDCKYIVVEKKDPK | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Polyclonal | |
| Rabbit | |
| Cancer | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| beta-microseminoprotein, IGBFProstate secreted seminal plasma protein, immunoglobulin binding factor, Immunoglobulin-binding factor, microseminoprotein, beta-, MSP, MSPB, PN44Prostate secretory protein of 94 amino acids, prostatic secretory protein 94, PRPS, PRSP, PSP, PSP57, PSP94HPC13, PSP-94Seminal plasma beta-inhibin | |
| MSMB | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title