missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PTP rho/PTPRT Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 461.00
Specifications
| Antigen | PTP rho/PTPRT |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
PTP rho/PTPRT Polyclonal specifically detects PTP rho/PTPRT in Human samples. It is validated for Western Blot.Specifications
| PTP rho/PTPRT | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Protein Phosphatase | |
| PBS buffer, 2% sucrose | |
| 11122 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| EC 3.1.3, EC 3.1.3.48, KIAA0283RPTPrho, protein tyrosine phosphatase, receptor type, T, receptor protein tyrosine phosphatase, Receptor-type tyrosine-protein phosphatase rho, receptor-type tyrosine-protein phosphatase T, RPTP-rho, R-PTP-T | |
| The immunogen is a synthetic peptide directed towards the middle region of human PTP rho/PTPRT (NP_008981.4). Peptide sequence QQFQFLGWPMYRDTPVSKRSFLKLIRQVDKWQEEYNGGEGRTVVHCLNGG | |
| Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title