missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PTP sigma/PTPRS Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-55570-25ul
This item is not returnable.
View return policy
Description
PTP sigma/PTPRS Polyclonal antibody specifically detects PTP sigma/PTPRS in Human samples. It is validated for Immunocytochemistry/ Immunofluorescence
Specifications
| PTP sigma/PTPRS | |
| Polyclonal | |
| Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL | |
| EC 3.1.3.48, protein tyrosine phosphatase PTPsigma, protein tyrosine phosphatase, receptor type, S, protein tyrosine phosphatase, receptor type, sigma, PTPSIGMA, receptor-type tyrosine-protein phosphatase S, Receptor-type tyrosine-protein phosphatase sigma, R-PTP-S, R-PTP-sigma | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: KPKVVVTKGAVLGRPTLSVQQTPEGSLLARWEPPAGTAEDQVLGYRLQFGREDSTPLATLEFPPSEDRYTASGVHK | |
| 25 μL | |
| Primary | |
| Human | |
| Purified |
| Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 5802 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction