missing translation for 'onlineSavingsMsg'
Learn More

PUS1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

€ 391.65 - € 590.10

Specifications

Antigen	PUS1
Applications	Western Blot, Immunocytochemistry, Immunofluorescence
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 2

Product Code	Brand	Quantity	Price	Quantity & Availability
Product Code	Brand	Quantity	Price	Quantity & Availability
18225012 View Documents missing translation for 'viewProductCertificates'	Novus Biologicals NBP2-56899	100 μL	€ 624.00 € 590.10 / 100µL Save € 33.90 5% Off View alternative products Save Up to »		Please sign in to purchase this item. Need a web account? Register with us today!

18674936 View Documents missing translation for 'viewProductCertificates'	Novus Biologicals NBP2-56899-25ul	25 μL	€ 415.00 € 391.65 / 25µL Save € 23.35 5% Off View alternative products Save Up to »		Please sign in to purchase this item. Need a web account? Register with us today!

Description

PUS1 Polyclonal specifically detects PUS1 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.

Specifications

Antigen	PUS1
Classification	Polyclonal
Host Species	Rabbit
Research Discipline	Core ESC Like Genes, Stem Cell Markers
Formulation	PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez)	80324
Immunogen	This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LKVWLIDDILEKINSHLPSHIRILGLKRVTGGFNSKNRCDARTYCYLLPTFAFAHKDRDVQDETYRLSAETLQQVNRLLACYKGTHNFHNFTSQ
Primary or Secondary	Primary
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

Applications	Western Blot, Immunocytochemistry, Immunofluorescence
Conjugate	Unconjugated
Regulatory Status	RUO
Target Species	Human
Gene Alias	EC 5.4.99.12, MGC11268, mitochondrial tRNA pseudouridine synthase A, MLASA1, pseudouridylate synthase 1, tRNA pseudouridine synthase A, mitochondrial, tRNA pseudouridylate synthase I, tRNA uridine isomerase I, tRNA-uridine isomerase I
Gene Symbols	PUS1
Isotype	IgG
Purification Method	Affinity Purified

For Research Use Only

Spot an opportunity for improvement?Share a Content Correction

Berichtigung von Produktinhalten

Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.

Name des Produkts

Ihr Name

E-Mail Adresse *

Art der Problems *

Detaillierte Beschreibung des Problems/der Anfrage *

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.

Abbrechen Absenden

Vielen Dank, dass Sie uns helfen, unsere Website zu verbessern. Ihr Feedback wurde übermittelt

PUS1 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents