missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PYK2/FAK2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
€ 386.00 - € 500.00
Specifications
| Antigen | PYK2/FAK2 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18430422
|
Novus Biologicals
NBP1-91228-25ul |
25 μL |
€ 386.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18353431
|
Novus Biologicals
NBP1-91228 |
0.1 mL |
€ 500.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
PYK2/FAK2 Polyclonal specifically detects PYK2/FAK2 in Human, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| PYK2/FAK2 | |
| Polyclonal | |
| Rabbit | |
| Angiogenesis, Apoptosis, Cancer, Cellular Markers, Protein Kinase, Signal Transduction, Tyrosine Kinases | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 2185 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:TLTSPMEYPSPVNSLHTPPLHRHNVFKRHSMREEDFIQPSSREEAQQLWEAEKVKMRQILDKQQKQMVEDYQWLRQEEKSLDPM | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human, Rat | |
| CADTKCAK-beta, CAK beta, CAKB, Calcium-dependent tyrosine kinase, Cell adhesion kinase beta, EC 2.7.10, FADK2, FAK2EC 2.7.10.2, Focal adhesion kinase 2, PKB, Proline-rich tyrosine kinase 2, protein kinase B, protein tyrosine kinase 2 beta, protein-tyrosine kinase 2-beta, PTK, PTK2B protein tyrosine kinase 2 beta, PYK2Related adhesion focal tyrosine kinase, RAFTKFADK 2 | |
| PTK2B | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title