missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
Pyridoxal Kinase/PDXK Polyclonal antibody specifically detects Pyridoxal Kinase/PDXK in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
Specifications
Specifications
| Antigen | Pyridoxal Kinase/PDXK |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Formulation | PBS (pH 7.2) and 40% Glycerol |
| Gene Alias | C21orf124, C21orf97, chromosome 21 open reading frame 124, DKFZp566A071, EC 2.7.1.35, FLJ21324, FLJ37311, MGC15873, MGC31754, MGC52346, PKHchromosome 21 open reading frame 97, PNKhuman pyridoxal kinase, EC 2.7.1.3510FLJ31940, PRED79, pyridoxal (pyridoxine, vitamin B6) kinase, pyridoxal kinase, pyridoxamine kinase, Pyridoxine kinase, vitamin B6 kinase |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PNNLKVACEKTVSTLHHVLQRTIQCAKAQAGEGVRPSPMQLELRMVQSKRDIEDPEIVVQATVL |
| Purification Method | Immunogen affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?