missing translation for 'onlineSavingsMsg'
Learn More

Pyridoxal Kinase/PDXK Antibody, Novus Biologicals™

Product Code. p-200049305 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
25 μL
Unit Size:
0.1mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18481781 25 μL 25µL
18442651 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18481781 Supplier Novus Biologicals Supplier No. NBP18828325ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

Pyridoxal Kinase/PDXK Polyclonal antibody specifically detects Pyridoxal Kinase/PDXK in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen Pyridoxal Kinase/PDXK
Applications Western Blot, Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:200 - 1:500
Formulation PBS (pH 7.2) and 40% Glycerol
Gene Alias C21orf124, C21orf97, chromosome 21 open reading frame 124, DKFZp566A071, EC 2.7.1.35, FLJ21324, FLJ37311, MGC15873, MGC31754, MGC52346, PKHchromosome 21 open reading frame 97, PNKhuman pyridoxal kinase, EC 2.7.1.3510FLJ31940, PRED79, pyridoxal (pyridoxine, vitamin B6) kinase, pyridoxal kinase, pyridoxamine kinase, Pyridoxine kinase, vitamin B6 kinase
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: PNNLKVACEKTVSTLHHVLQRTIQCAKAQAGEGVRPSPMQLELRMVQSKRDIEDPEIVVQATVL
Purification Method Immunogen affinity purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline metabolism
Primary or Secondary Primary
Gene ID (Entrez) 8566
Target Species Human, Mouse
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.