missing translation for 'onlineSavingsMsg'
Learn More

C22orf28, Rabbit, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant C22orf28.

Brand: Abnova PAB20033.100uL

Product Code. 16123170

€ 619.00 / 100µL

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Sequence: PDDLDLHVIYDVSHNIAKVEQHVVDGKERTLLVHRKGSTRAFPPHHPLIAVDYQLTGQPVLIGGTMGTCSYVLTGTEQGMTETFGTTCHGAGRALSRAKSRRNLDFQDVLDKLADMGIAIRVASPKLVMEEAPESYKNVTDVVNTCHDAGISKKAIKLRP

Specifications

Antigen	C22orf28
Classification	Polyclonal
Description	Rabbit polyclonal antibody raised against recombinant C22orf28.
Formulation	In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
Gene Accession No.	Q9Y3I0
Gene Symbols	C22orf28
Immunogen	Recombinant protein corresponding to amino acids of human C22orf28.
Quantity	100 μL
Primary or Secondary	Primary
Target Species	Human
Form	Liquid

Applications	Immunohistochemistry (PFA fixed), Western Blot
Conjugate	Unconjugated
Dilution	Immunohistochemistry (1:20-1:50) Western Blot (1:250-1:500) The optimal working dilution should be determined by the end user.
Gene	C22orf28
Gene Alias	DJ149A16.6/HSPC117/RP1-149A16.6
Host Species	Rabbit
Purification Method	Antigen affinity purification
Regulatory Status	RUO
Gene ID (Entrez)	51493
Content And Storage	Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing.
Isotype	IgG

Product Suggestions

Product Content Correction

Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.

Produkttitel

Dit navn

E-mailadresse *

Type af problem *

Detaljeret beskrivelse af problem/anmodning *

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.

Annuller Send

Mange tak! Din feedback er blevet sendt. Hos Fisher Scientific arbejder vi altid på at forbedre vores indhold for dig. Vi sætter pris på din feedback.

For Research Use Only

Ser du en mulighed for forbedring?Del en indholdskorrektion

C22orf28, Rabbit, Polyclonal Antibody, Abnova™

Description

Specifications

Product Suggestions

Documents

Promotions