missing translation for 'onlineSavingsMsg'
Learn More

COPB2, Rabbit, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant COPB2.

Brand: Abnova PAB23074.100uL

Product Code. 16195660

€ 505.00 / 100µL

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

The Golgi coatomer complex (see MIM 601924) constitutes the coat of nonclathrin-coated vesicles and is essential for Golgi budding and vesicular trafficking. It consists of 7 protein subunits, including COPB2.[supplied by OMIM

Sequence: VALGYDEGSIIVKLGREEPAMSMDANGKIIWAKHSEVQQANLKAMGDAEIKDGERLPLAVKDMGSCEIYPQTIQHNPNGRFVVVCGDGEYIIYTA

Specifications

Antigen	COPB2
Classification	Polyclonal
Description	Rabbit polyclonal antibody raised against recombinant COPB2.
Formulation	In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
Gene Accession No.	P35606
Gene Symbols	COPB2
Immunogen	Recombinant protein corresponding to amino acids of human COPB2.
Quantity	100 μL
Primary or Secondary	Primary
Target Species	Human
Form	Liquid

Applications	Immunohistochemistry, Western Blot, Western Blot
Conjugate	Unconjugated
Dilution	Immunohistochemistry (1:50-1:200) Western Blot (1:250-1:500) The optimal working dilution should be determined by the end user.
Gene	COPB2
Gene Alias	beta'-COP
Host Species	Rabbit
Purification Method	Antigen affinity purification
Regulatory Status	RUO
Gene ID (Entrez)	9276
Content And Storage	Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing.
Isotype	IgG

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

For Research Use Only

Spot an opportunity for improvement?Share a Content Correction

COPB2, Rabbit, Polyclonal Antibody, Abnova™

Description

Specifications

Product Suggestions

Documents

Promotions