missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ERGIC1 Rabbit anti-Human, Polyclonal Antibody, Abnova™
Description
This gene encodes a cycling membrane protein which is an endoplasmic reticulum-golgi intermediate compartment (ERGIC) protein which interacts with other members of this protein family to increase their turnover. [provided by RefSeq
Sequence: VVNELYVDDPDKDSGGKIDVSLNISLPNLHCELVGLDIQDEMGRHEVGHIDNSMKIPLNNGAGCRFEGQFSINK
Specifications
Specifications
| Antigen | ERGIC1 |
| Applications | Immunohistochemistry (PFA fixed), Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Description | Rabbit polyclonal antibody raised against recombinant ERGIC1. |
| Dilution | Immunohistochemistry (1:20-1:50) Western Blot (1:250-1:500) The optimal working dilution should be determined by the end user. |
| Formulation | In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide) |
| Gene | ERGIC1 |
| Gene Accession No. | Q969X5 |
| Gene Alias | ERGIC-32/ERGIC32/FLJ39864/KIAA1181/MGC14345 |
| Show More |
For Research Use Only
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?