missing translation for 'onlineSavingsMsg'
Learn More

Rrbp1, Rabbit, Polyclonal Antibody, Abnova™

Product Code. 16031697
Change view
Click to view available options
Quantity:
100 μg
Unit Size:
100µg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
16031697 100 μg 100µg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 16031697 Supplier Abnova Supplier No. PAB15696.100ug

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit polyclonal antibody raised against partial recombinant Rrbp1.

Sequence: AVPPAEQDPMKLKTQLERTEATLEDEQTRRQKLTAEFEEAQRTACRIQEELEELRAASPLGSSAKEEVTQLKERLEKEKRLTSDLGRAAIKLQELLKTTQEQLTKEKDTVKKLQEQLGKAEDGSSSKEGTSV

Specifications

Antigen Rrbp1
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Description Rabbit polyclonal antibody raised against partial recombinant Rrbp1.
Dilution Western Blot (1:1000) The optimal working dilution should be determined by the end user.
Formulation In PBS (50% glycerol, 0.02% sodium azide)
Gene Rrbp1
Gene Alias 1700087N07Rik/5730465C04Rik/ES/130/mKIAA1398/mRRp0/mRRp1.8/mRRp10/mRRp15a/mRRp15b/mRRp16.8/mRRp2/mRRp41/mRRp47/mRRp5.4/p180
Gene Symbols Rrbp1
Host Species Rabbit
Immunogen Recombinant GST fusion protein corresponding to 132 mouse Rrbp1.
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 81910
Test Specificity Specific to recombinant protein GX0745. This antibody detects endogenous mRRBP1 protein in several cell types.
Target Species Mouse
Content And Storage Store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Form Liquid
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.