missing translation for 'onlineSavingsMsg'
Learn More

SLC26A11, Rabbit, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant SLC26A11.

Brand: Abnova PAB22367.100uL

Product Code. 16135090

€ 619.00 / 100µL

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Like most members of the SLC26A family, SLC26A11 is a sodium-independent sulfate transporter (Vincourt et al., 2003 [PubMed 12626430]).[supplied by OMIM

Sequence: SAARPETKVSEGPVLVLQPASGLSFPAMEALREEILSRALEVSPPRCLVLECTHVCSIDYTVVLGLGELL

Specifications

Antigen	SLC26A11
Classification	Polyclonal
Description	Rabbit polyclonal antibody raised against recombinant SLC26A11.
Formulation	In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
Gene Alias	MGC46523
Host Species	Rabbit
Purification Method	Antigen affinity purification
Regulatory Status	RUO
Gene ID (Entrez)	284129
Content And Storage	Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing.
Isotype	IgG

Applications	Immunohistochemistry (PFA fixed), Western Blot
Conjugate	Unconjugated
Dilution	Immunohistochemistry (1:50-1:200) Western Blot (1:250-1:500) The optimal working dilution should be determined by the end user.
Gene	SLC26A11
Gene Symbols	SLC26A11
Immunogen	Recombinant protein corresponding to amino acids of human SLC26A11.
Quantity	100 μL
Primary or Secondary	Primary
Target Species	Human
Form	Liquid

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

For Research Use Only

Spot an opportunity for improvement?Share a Content Correction

SLC26A11, Rabbit, Polyclonal Antibody, Abnova™

Description

Specifications

Product Suggestions

Documents

Promotions