missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RABIF/MSS4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 433.00 - € 572.00
Specifikationer
| Antigen | RABIF/MSS4 |
|---|---|
| Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:20-1:50 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Produktkod | Brand | Quantity | Pris | Kvantitet och tillgänglighet | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktkod | Brand | Quantity | Pris | Kvantitet och tillgänglighet | |||||
|
18487010
|
Novus Biologicals
NBP1-81024-25ul |
25ul |
€ 433.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18217665
|
Novus Biologicals
NBP1-81024 |
0.1 mL |
€ 572.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Beskrivning
RABIF/MSS4 Polyclonal specifically detects RABIF/MSS4 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifikationer
| RABIF/MSS4 | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| mammalian suppressor of SEC4, mss4, MSS4guanine nucleotide exchange factor MSS4, RAB interacting factor, Rab-interacting factor, RASGFR3, RASGRF3, Ras-specific guanine-releasing factor 3 | |
| RABIF | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot 0.4 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:20-1:50 | |
| Polyclonal | |
| Rabbit | |
| Signal Transduction | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 5877 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:MEPAEQPSELVSAEGRNRKAVLCQRCGSRVLQPGTALFSRRQLFLPSMRKKPALSDGSNPD | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Hittar du en möjlighet till förbättring?Dela en innehållskorrigering
Korrigering av produktinnehåll
Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.
Produkttitel