missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RAD54L Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35923-100ul
This item is not returnable.
View return policy
Description
RAD54L Polyclonal antibody specifically detects RAD54L in Mouse,Rat samples. It is validated for ELISA,Western Blot
Specifications
| RAD54L | |
| Polyclonal | |
| Western Blot 1:500 - 1:1000, ELISA | |
| EC 3.6.1, hHR54EC 3.6.4.-, HR54, hRAD54HRAD54, RAD54 (S.cerevisiae)-like, RAD54 homolog, RAD54ADNA repair and recombination protein RAD54-like, RAD54-like (S. cerevisiae) | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 648-747 of human RAD54L (Q92698).,, Sequence:, EEQDVERHFSLGELKELFILDEASLSDTHDRLHCRRCVNSRQIRPPPDGSDCTSDLAGWNHCTDKWGLRDEVLQAAWDAASTAITFVFHQRSHEEQRGLR | |
| 100 μL | |
| DNA Repair, Homologous Recombination | |
| 8438 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction