missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RAE1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-58733-25ul
This item is not returnable.
View return policy
Description
RAE1 Polyclonal specifically detects RAE1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Specifications
| RAE1 | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 1-4 μg/mL | |
| dJ481F12.3, dJ800J21.1, FLJ30608, homolog of yeast Rae1 (Bharathi) mRNA-associated protein of 41 kDa (Kraemer), MGC117333, MGC126076, MGC126077, MIG14, migration-inducing gene 14, Mnrp41, mRNA export factor, mRNA export protein, mRNA-associated protein mrnp 41, mRNA-binding protein, 41-kD, MRNP41, RAE1 (RNA export 1, S.pombe) homolog, Rae1 protein homolog, RAE1 RNA export 1 homolog (S. pombe) | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 8480 | |
| Human | |
| IgG |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide | |
| RAE1 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VHGTLATVGSDGRFSFWDKDARTKLKTSEQLDQPISACCFNHNGNIFAYASSYDWSKGHEFYNPQKKNYIFLRNAAEELKPRNKK | |
| 25 μL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction