missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. RAI16 Antibody - BSA Free, Novus Biologicals™

RAI16 Antibody - BSA Free, Novus Biologicals™

Product Code. p-200062414 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.02 mL
0.1 mL
Unit Size:
0.01mL
0.02mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18657090 0.02 mL 0.02mL
18694900 0.1 mL 0.01mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18657090 Supplier Novus Biologicals Supplier No. NBP2946070.02ml

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

RAI16 Polyclonal antibody specifically detects RAI16 in Human, Mouse, Rat samples. It is validated for Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen RAI16
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:500 - 1:2000
Formulation PBS (pH 7.3), 50% glycerol
Gene Alias family with sequence similarity 160, member B2, FLJ11125, FLJ21801, MGC138352, RAI16, retinoic acid induced 16, Retinoic acid-induced protein 16
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 420-520 of human FAM160B2 (NP_073586.5). DRQPEAPGDNPHTLYAHLIGHCDHLSDEISITTLRLFEELLQKPHEGIIHSLVLRNLEGRPYVAWGSPEPESYEDTLDLEEDPYFTDSFLDSGFQTPAKPR
Purification Method Affinity purified
Quantity 0.02 mL
Regulatory Status RUO
Research Discipline Cell Biology
Primary or Secondary Primary
Gene ID (Entrez) 64760
Target Species Human, Mouse, Rat
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.