missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RALYL Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-33768
This item is not returnable.
View return policy
Description
RALYL Polyclonal specifically detects RALYL in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| RALYL | |
| Polyclonal | |
| Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| Q86SE5 | |
| RALYL | |
| This antibody was developed against a recombinant protein corresponding to amino acids: SLVLIQEECVSEIADHSTEEPAEGGPDADGEEMTDGIEEDFDEDGGHELFLQIK | |
| 0.1 mL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| hnRNP core protein C-like 3, HNRPCL3Heterogeneous nuclear ribonucleoprotein C-like 3, hRALYL, RALY RNA binding protein-like, RNA-binding Raly-like protein | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 138046 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction