missing translation for 'onlineSavingsMsg'
Learn More

RAPGEF3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand: Novus Biologicals NBP1-57044

View more versions of this product

Product Code. 18288382

€ 483.00 / 100µL

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

RAPGEF3 Polyclonal specifically detects RAPGEF3 in Human samples. It is validated for Western Blot.

Specifications

Antigen	RAPGEF3
Classification	Polyclonal
Conjugate	Unconjugated
Formulation	PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias	9330170P05Rik, bcm910, cAMP-GEFI, cAMP-regulated guanine nucleotide exchange factor I, CGEF1, EPAC 1, EPAC1, EPACRAP guanine-nucleotide-exchange factor (GEF) 3, Exchange factor directly activated by cAMP 1, Exchange protein directly activated by cAMP 1, HSU79275, MGC21410, Rap guanine nucleotide exchange factor (GEF) 3, rap guanine nucleotide exchange factor 3, Rap1 guanine-nucleotide-exchange factor directly activated by cAMP
Host Species	Rabbit
Purification Method	Affinity purified
Regulatory Status	RUO
Primary or Secondary	Primary
Test Specificity	Expected identity based on immunogen sequence: Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Bovine: 92%; Canine: 92%; Guinea pig: 92%; Equine: 92%.
Target Species	Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
Isotype	IgG

Applications	Western Blot
Concentration	0.5 mg/ml
Dilution	Western Blot 1.0 ug/ml
Gene Accession No.	A8K2G5
Gene Symbols	RAPGEF3
Immunogen	Synthetic peptides corresponding to RAPGEF3 (Rap guanine nucleotide exchange factor (GEF) 3) The peptide sequence was selected from the N terminal of RAPGEF3. Peptide sequence RSQVVGICQVLLDEGALCHVKHDWAFQDRDAQFYRFPGPEPEPVGTHEME.
Quantity	100 μL
Research Discipline	Signal Transduction
Gene ID (Entrez)	10411
Reconstitution	Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

Spot an opportunity for improvement?Share a Content Correction

RAPGEF3 Antibody, Novus Biologicals™

Description

Specifications

Product Suggestions

Documents

Promotions