missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RAPGEF3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 483.00
Specifications
| Antigen | RAPGEF3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
RAPGEF3 Polyclonal specifically detects RAPGEF3 in Human samples. It is validated for Western Blot.Specifications
| RAPGEF3 | |
| Polyclonal | |
| Rabbit | |
| Signal Transduction | |
| 9330170P05Rik, bcm910, cAMP-GEFI, cAMP-regulated guanine nucleotide exchange factor I, CGEF1, EPAC 1, EPAC1, EPACRAP guanine-nucleotide-exchange factor (GEF) 3, Exchange factor directly activated by cAMP 1, Exchange protein directly activated by cAMP 1, HSU79275, MGC21410, Rap guanine nucleotide exchange factor (GEF) 3, rap guanine nucleotide exchange factor 3, Rap1 guanine-nucleotide-exchange factor directly activated by cAMP | |
| RAPGEF3 | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| A8K2G5 | |
| 10411 | |
| Synthetic peptides corresponding to RAPGEF3 (Rap guanine nucleotide exchange factor (GEF) 3) The peptide sequence was selected from the N terminal of RAPGEF3. Peptide sequence RSQVVGICQVLLDEGALCHVKHDWAFQDRDAQFYRFPGPEPEPVGTHEME. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title