missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RASSF10 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 391.65 - € 590.10
Specifications
| Antigen | RASSF10 |
|---|---|
| Dilution | Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL |
| Applications | Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18629576
|
Novus Biologicals
NBP2-68639-25ul |
25 μL |
€ 415.00 € 391.65 / 25µL Save € 23.35 5% Off |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18653867
|
Novus Biologicals
NBP2-68639 |
100 μg |
€ 624.00 € 590.10 / 100µL Save € 33.90 5% Off |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
RASSF10 Polyclonal antibody specifically detects RASSF10 in Human samples. It is validated for Immunocytochemistry/ ImmunofluorescenceSpecifications
| RASSF10 | |
| Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Cancer, Cell Cycle and Replication | |
| PBS (pH 7.2) and 40% Glycerol | |
| 644943 | |
| IgG | |
| Protein A purified |
| Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| Peptidylglycine Alpha-Amidating Monooxygenase COOH-Terminal Interactor-Like, Ras Association (RalGDS/AF-6) Domain Family (N-Terminal) Member 10, Ras Association Domain-Containing Protein 10 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: RRCDDLLRLQEQRVQQEELLERLSAEIQEELNQRWMRRRQEELAAREEPLEPDGGPDGELLLEQERVRTQLSTSLYIGLRLNTDLEA | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title