missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RBBP6 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 280.00 - € 624.00
Specifications
| Antigen | RBBP6 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18260384
|
Novus Biologicals
NBP2-58777 |
100 μL |
€ 624.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18687268
|
Novus Biologicals
NBP2-58777-25ul |
25 μL |
€ 280.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
RBBP6 Polyclonal specifically detects RBBP6 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| RBBP6 | |
| Polyclonal | |
| Rabbit | |
| Tumor Suppressors | |
| E3 ubiquitin-protein ligase RBBP6, EC 6.3.2.-, MY038, P2PR, P2P-R, p53-associated cellular protein of testis, PACTDKFZp761B2423, Proliferation potential-related protein, Protein P2P-R, RB-binding Q-protein 1, RBQ1, RBQ-1, retinoblastoma binding protein 6, Retinoblastoma-binding protein 6DKFZp686P0638, Retinoblastoma-binding Q protein 1, SNAMA | |
| RBBP6 | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| 5930 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TMEEYNNDNTAPAEDVIIMIQVPQSKWDKDDFESEEEDVKSTQPISSVGKPASVIKNVSTKPSNIVKYPEKESEPSEKIQKFTKDVSHE | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title