missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RBBP9 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 415.00 - € 624.00
Specifications
| Antigen | RBBP9 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18207222
|
Novus Biologicals
NBP2-55018 |
100 μL |
€ 624.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18698556
|
Novus Biologicals
NBP2-55018-25ul |
25 μL |
€ 415.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
RBBP9 Polyclonal specifically detects RBBP9 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| RBBP9 | |
| Polyclonal | |
| Rabbit | |
| Signal Transduction | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 10741 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PWQWEKIKANCPYIVQFGSTDDPFLPWKEQQEVADRLETKLHKFTDCGHFQNTEFHELITVVKSLLKVPA | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| B5T-overexpressed gene protein, Bog, BOGB5T overexpressed gene protein, EC 3.-, Protein BOG, putative hydrolase RBBP9, RBBP10, RBBP-10, RBBP-9, retinoblastoma binding protein 9, Retinoblastoma-binding protein 10, Retinoblastoma-binding protein 9MGC9236, retinoma-binding protein 9 | |
| RBBP9 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title