missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. RBFOX3/NeuN Antibody, Novus Biologicals™

RBFOX3/NeuN Antibody, Novus Biologicals™

Product Code. 18767823 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
Unit Size:
0.10mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18767823 0.1 mL 0.10mL
18457691 25 μL 25µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18767823 Supplier Novus Biologicals Supplier No. NBP189821

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody has been used in 2 publications

RBFOX3/NeuN Polyclonal specifically detects RBFOX3/NeuN in Human samples. It is validated for Immunocytochemistry/Immunofluorescence, Immunohistochemistry, Immunohistochemistry (Paraffin).
TRUSTED_SUSTAINABILITY

Specifications

Applications Immunocytochemistry/Immunofluorescence, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Concentration 0.1mg/mL
Conjugate Unconjugated
Dilution Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias FLJ56884, FLJ58356, Fox-1 homolog C, FOX3, FOX-3, hexaribonucleotide binding protein 3, HRNBP3, NeuN, neuronal nuclei, RBFOX3, RNA binding protein fox-1 homolog 3, RNA binding protein, fox-1 homolog (C. elegans) 3
Gene Symbols RBFOX3
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:PTQDYSGQTPVPTEHGMTLYTPAQTHPEQPGSEASTQPIAGTQTVPQTDEAAQTDSQPLHPSDPTEKQQ
Purification Method Affinity Purified
Quantity 0.1 mL
Research Discipline DNA replication Transcription Translation and Splicing, Neuronal Cell Markers, Neuroscience
Primary or Secondary Primary
Gene ID (Entrez) 146713
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.