missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RBM15 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-56787-25ul
Les retours ne sont pas autorisés pour ce produit.
Afficher la politique du retour.
Description
RBM15 Polyclonal specifically detects RBM15 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.
Spécification
| RBM15 | |
| Polyclonal | |
| Western Blot 0.4 μg/mL, Immunocytochemistry/Immunofluorescence 1-4 μg/mL | |
| FLJ12479, one twenty two protein, one twenty-two, One-twenty two protein 1, putative RNA-binding protein 15, RNA binding motif protein 15, RNA-binding motif protein 15, SPEN | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 64783 | |
| Human | |
| Purified |
| Western Blot, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| RBM15 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:RGARDRTPPLLYRDRDRDLYPDSDWVPPPPPVRERSTRTAATSVPAYEPLDSLDRRRDGWSLDRDRGDRDLPSSRDQPRKRRLPEESGGRHLDRSPESDRPRKRHC | |
| 25 μL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. | |
| IgG |
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit
For Research Use Only
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu