missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RBM15B Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-58773-25ul
This item is not returnable.
View return policy
Description
RBM15B Polyclonal specifically detects RBM15B in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Specifications
| RBM15B | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 1-4 μg/mL | |
| chromosome 3p21.1 gene sequence, HUMAGCGB, one-twenty two protein 3, RNA binding motif protein 15B, RNA-binding motif protein 15B | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 29890 | |
| Human | |
| IgG |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide | |
| RBM15B | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LHGGYQYKQRSLSPVAAPPLREPRARHAAAAFALDAAAAAAVGLSRERALDYYGLYDDRGRPYGYPAVCEEDLMPEDDQRAT | |
| 25 μL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
For Research Use Only
Spot an opportunity for improvement?