missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RBM25 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 280.00 - € 589.00
Specifications
| Antigen | RBM25 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18218364
|
Novus Biologicals
NBP2-57656 |
100 μL |
€ 589.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18677138
|
Novus Biologicals
NBP2-57656-25ul |
25 μL |
€ 280.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
RBM25 Polyclonal specifically detects RBM25 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| RBM25 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| 58517 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:FPPPVPPGTPMIPVPMSIMAPAPTVLVPTVSMVGKHLGARKDHPGLKAKENDENCGPTTTVFVGNISEKASDMLIRQLLAKCGLVLSW | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Arg/Glu/Asp-rich protein of 120 kDa, Arg/Glu/Asp-rich protein, 120 kDa, fSAP94, functional spliceosome-associated protein 94, MGC105088, MGC117168, NET52, Protein S164, RED120RNA-binding region-containing protein 7, RNA binding motif protein 25, RNA-binding motif protein 25, RNA-binding protein 25, RNA-binding region (RNP1, RRM) containing 7, RNPC7, S164, Snu71, U1 small nuclear ribonucleoprotein 1SNRP homolog | |
| RBM25 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title