missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RBMY1F Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-94712-0.1ml
This item is not returnable.
View return policy
Description
RBMY1F Polyclonal antibody specifically detects RBMY1F in Rat samples. It is validated for Western Blot
Specifications
| RBMY1F | |
| Polyclonal | |
| Western Blot 1:500-1:2000 | |
| MGC33094, RNA binding motif protein, Y-linked, family 1, member F, RNA-binding motif protein, Y chromosome, family 1 member F/J, Y chromosome RNA recognition motif 2, YRRM2 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human RBMY1F (NP_689798.1). MVEADHPGKLFIGGLNRETNEKMLKAVFGKHGPISEVLLIKDRTSKSRGFAFITFENPADAKNAAKDMNGTSLHGKAIKV | |
| 0.1 mL | |
| Cell Biology, Stem Cells | |
| 159163 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction