missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RBMY1F Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-94712-0.02ml
This item is not returnable.
View return policy
Description
RBMY1F Polyclonal antibody specifically detects RBMY1F in Rat samples. It is validated for Western Blot
Specifications
| RBMY1F | |
| Polyclonal | |
| Western Blot 1:500-1:2000 | |
| MGC33094, RNA binding motif protein, Y-linked, family 1, member F, RNA-binding motif protein, Y chromosome, family 1 member F/J, Y chromosome RNA recognition motif 2, YRRM2 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human RBMY1F (NP_689798.1). MVEADHPGKLFIGGLNRETNEKMLKAVFGKHGPISEVLLIKDRTSKSRGFAFITFENPADAKNAAKDMNGTSLHGKAIKV | |
| 0.02 mL | |
| Cell Biology, Stem Cells | |
| 159163 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Rat | |
| Purified |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?