missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. RCE1 Antibody, Novus Biologicals™

RCE1 Antibody, Novus Biologicals™

Product Code. 30228793 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
Unit Size:
100µL
20µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30228793 100 μL 100µL
30227749 20 μL 20µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 30228793 Supplier Novus Biologicals Supplier No. NBP335836100ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

RCE1 Polyclonal antibody specifically detects RCE1 in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin),Immunocytochemistry/Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen RCE1
Applications ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin), Immunocytochemistry/Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:500 - 1:2000, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulation PBS (pH 7.3), 50% glycerol
Gene Alias CAAX prenyl protease 2, EC 3.4.22.-, FACE-2, FACE2RCE1 homolog, prenyl protein protease (S. cerevisiae), farnesylated protein-converting enzyme 2, Farnesylated proteins-converting enzyme 2, hRCE1, Prenyl protein-specific endoprotease 2, RCE1 (S. Cerevisiae) homolog, prenyl protein protease, RCE1 homolog, RCE1 homolog, prenyl protein peptidase (S. cerevisiae), RCE1 homolog, prenyl protein protease, RCE1A, RCE1B
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human RCE1 (NP_005124.1).,, Sequence:, SLLTLMGFRLEGIFPAALLPLLLTMILFLGPLMQLSMDCPCDLADGLKVVLAPRSWARCLTDMRWLRNQVIAPLTEELVFRACMLPMLAPCMGLGPAVFTC
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 9986
Target Species Human, Mouse, Rat
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.