missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RCN1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 280.00 - € 624.00
Specifications
| Antigen | RCN1 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18100799
|
Novus Biologicals
NBP2-37987 |
0.1 mL |
€ 624.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18645605
|
Novus Biologicals
NBP2-37987-25ul |
25 μL |
€ 280.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
RCN1 Polyclonal specifically detects RCN1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| RCN1 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Q15293 | |
| 5954 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: KPTVRKERVVRPDSELGERPPEDNQSFQYDHEA | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| FLJ37041, FLJ55835, PIG20, proliferation-inducing gene 20, RCAL, RCN, reticulocalbin 1, EF-hand calcium binding domain, reticulocalbin-1 | |
| RCN1 | |
| IgG | |
| Affinity Purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title