missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant Hepatitis C HCV NS4 a+b Protein

A cDNA sequence encoding the HCV NS4 a+b was constructed and used to recombinantly synthesize the protein.

Brand:  enQuireBio™ QP12178-B-100ug

Additional Details : Weight : 0.01000kg

 View more versions of this product

Product Code. 15939608

  • € 338.00 / 100µg

Estimated Shipment: 02-02-2023
to see stock.
Add to basket

Description

Description

Specifications

Specifications

Hepatitis C HCV NS4 a+b Protein
100 μg
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Hepatitis C
Biotin
(1 mg/ml) 20mM Tris-HCl pH 8 and 8M urea.
HCV NS4 a+b Biotin protein is >95% pure as determined by 10% PAGE (coomassie staining).
Research Use Only
Recombinant Protein
E. coli
1658 TWVLVGGVLAALAAYCLSTGCVVIVGRVVLSGKPAIIPDREVLYREFDEMEECSQHLPYIEQGMMLAEQFKQKALGLLQTASRQAEVIAPAVQTNWQKLETFWAKHMWNFISGIQYLAGLSTLPGNPAIASLMAFTAAVTSPLTTSQTLLFNILGGWVAAQLAAPGAATAFVGAGLAGAAIGSVGLGKVLIDILAGYGAGVAGAL 1863
Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers