missing translation for 'onlineSavingsMsg'
Learn More
Learn More
enQuireBio™ Recombinant HPV HPV 18 Protein
A cDNA sequence encoding the HPV 18 was constructed and used to recombinantly synthesize the protein.
€ 238.00 - € 1815.00
Specifications
Name | HPV HPV 18 Protein |
---|---|
Regulatory Status | Research Use Only |
Endotoxin Concentration | Not Determined. Testing recommended prior to use in cell culture and can be performed upon request. |
Product Type | Recombinant Protein |
Cross Reactivity | HPV |
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
15920009
|
enQuireBio™
QP12308-100UG |
100 μg |
€ 238.00
100µg |
Estimated Shipment: 24-06-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
15940009
|
enQuireBio™
QP12308-500UG |
500 μg |
€ 910.00
500µg |
Estimated Shipment: 24-06-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
15930009
|
enQuireBio™
QP12308-1MG |
1 mg |
€ 1815.00
1mg |
Estimated Shipment: 24-06-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
Specifications
HPV HPV 18 Protein | |
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request. | |
HPV | |
GST | |
Recombinant HPV-18 solution in PBS, 3M Urea and 0.02% sodium azide as preservative. |
Research Use Only | |
Recombinant Protein | |
E. coli | |
VDVYLPPPSVARVVNTDDYVTPTSIFYHAGSSRLLTVGNPYFRVPAGGGNKQDIPKVSAYQYRVFRVQLPDPNKFGLPDTSIYNPETQRLVWACAGVEIGRGQPLGVGLSGHPFYNKLDDTESSHAATSNVSEDVRDNVSVDYKQTQLCILGCAPAIGEHWAKGTACKSRPLSQGDCPPLELKNTVLEDGDMVDTGYGAMDFSTLQDTKCEVPLDICQSICKYPDYLQMSADPYGDSMFFCLRREQLFARHFWNRAGTMGDTVPQSLYIKGTGMPASPGSCVYSPSPSGSIVTSDSQLFNKPYWLHKAQGHNNGVCWHNQLFVTVVDTTPSTNLTICASTQSPVPGQYDATKFKQYSRHVEEYDLQFIFQLCTITLTADVMSYIHSMNSSILEDWNFGVPPPPTTSLVDTYRFVQSVAITCQKDAAPAENKDPYDKLKFWNVDLKEKFSLDLDQYPLGRKFLVQAGLRRKPTIGPRKRSAPSATTSSKPA | |
Protein is >90% pure as determined by 10% PAGE (Coomassie staining). |